PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00052246-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family Nin-like
Protein Properties Length: 275aa    MW: 30452.6 Da    PI: 4.7229
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00052246-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.61.2e-28204253352
            RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        +i+l++ls+yF++pi++AAkeL+v+lTvLK++CR++GI+RWPhRk+ksl
  PSME_00052246-RA 204 TDITLNELSHYFNMPITQAAKELKVGLTVLKKRCREFGIPRWPHRKMKSL 253
                       689*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.905187273IPR003035RWP-RK domain
PfamPF020423.0E-23206253IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MFQAAIPRLE SVPRNSDLID ISPLSEDLNI VDDIFDTKDI LDPSYCLPSL CESSDIADPA  60
SCSLSKPLLL QSNPPEWDIS NWSSIPAASM ANQIMNPANE FLLEDQKLAG DKSIAGTSHL  120
SLSCPPSNVP DEALEYIFPV CYNLPAMPET SNAISVSSAP SLIHDDPNYL NSSWNGINSE  180
TAISISAPSG HSRSNQRGSS DRITDITLNE LSHYFNMPIT QAAKELKVGL TVLKKRCREF  240
GIPRWPHRKM KSLESLIHNI QVLYMLKQLQ FLLFH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.14e-24RWP-RK domain-containing protein